TFAP4, Mouse, Clone: 7C5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TFAP4.

Supplier:  Abnova Corporation H00007023M02A

Catalog No. 89-105-576

Description

Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular genes by binding to the symmetrical DNA sequence CAGCTG (Mermod et al., 1988 [PubMed 2833704]; Hu et al., 1990 [PubMed 2123466]).[supplied by OMIM

Sequence: AEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIA

Specifications

• Antigen: TFAP4
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_003223
• Gene Symbols: TFAP4
• Immunogen: TFAP4 (NP_003214,93 a.a. ∽ 192 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 7023
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 7C5
• Description: Mouse monoclonal antibody raised against a partial recombinant TFAP4.
• Gene: TFAP4
• Gene Alias: AP-4/bHLHc41
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ