TFF3, Mouse, Clone: 3G11, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant TFF3.

Supplier:  Abnova Corporation H00007033M02A

Catalog No. 89-105-582

Description

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq

Sequence: EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF

Specifications

• Antigen: TFF3
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC017859
• Gene Symbols: TFF3
• Immunogen: TFF3 (AAH17859.1,15 a.a. ∽ 73 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 7033
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 3G11
• Description: Mouse monoclonal antibody raised against a full-length recombinant TFF3.
• Gene: TFF3
• Gene Alias: HITF/ITF/TFI/hP1.B
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ