TFF3, Mouse, Clone: 3G11, Abnova™

Catalog No.	Quantity
89-105-582	200 μL

Catalog No. 89-105-582 Supplier Abnova Corporation Supplier No. H00007033M02A

Description

Mouse monoclonal antibody raised against a full-length recombinant TFF3.

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq

Sequence: EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF

Specifications

• Antigen: TFF3
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3G11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant TFF3.
• Formulation: ascites with no preservative
• Gene: TFF3
• Gene Accession No.: BC017859
• Gene Alias: HITF/ITF/TFI/hP1.B
• Gene Symbols: TFF3
• Host Species: Mouse
• Immunogen: TFF3 (AAH17859.1,15 a.a. ∽ 73 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7033
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ