TGM2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-591	50 μL

Catalog No. 89-105-591 Supplier Abnova Corporation Supplier No. H00007052A01

Description

Mouse polyclonal antibody raised against a partial recombinant TGM2.

Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites and their activity is calcium-dependent. The protein encoded by this gene acts as a monomer, is induced by retinoic acid, and appears to be involved in apoptosis. Finally, the encoded protein is the autoantigen implicated in celiac disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE

Specifications

• Antigen: TGM2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TGM2.
• Formulation: 50% glycerol
• Gene: TGM2
• Gene Accession No.: BC003551
• Gene Alias: G-ALPHA-h/GNAH/TG2/TGC
• Gene Symbols: TGM2
• Host Species: Mouse
• Immunogen: TGM2 (AAH03551, 1 a.a. ∽ 120 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7052
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only