Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89106912

TH1L, Mouse, Clone: 3C9, Abnova™

Catalog No. 89106912 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-912 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-912 Supplier Abnova Corporation Supplier No. H00051497M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant TH1L.

The NELF complex of proteins interacts with the DSIF protein complex to repress transcriptional elongation by RNA polymerase II. The protein encoded by this gene is an essential part of the NELF complex. Alternative translation initiation site usage results in the formation of two isoforms with different N-termini. [provided by RefSeq

Sequence: ELKKTLLDRMVHLLSRGYVLPVVSYIRKCLEKLDTDISLIRYFVTEVLDVIAPPYTSDFVQLFLPILENDSIAGTIKTEGEHDPVTEFIAHCKSNFIMVN

Specifications

Antigen TH1L
Applications ELISA
Classification Monoclonal
Clone 3C9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant TH1L.
Formulation ascites with no preservative
Gene TH1L
Gene Accession No. NM_016397
Gene Alias HSPC130/NELF-C/NELF-D/TH1
Gene Symbols TH1L
Host Species Mouse
Immunogen TH1L (NP_057481.2,491 a.a. ∽ 590 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51497
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.