TLN1, Mouse, Clone: 2B11, Abnova™

Catalog No.	Quantity
89-105-622	200 μL

Catalog No. 89-105-622 Supplier Abnova Corporation Supplier No. H00007094M80A

Description

Mouse monoclonal antibody raised against a partial recombinant TLN1.

This gene encodes a cytoskeletal protein that is concentrated in areas of cell-substratum and cell-cell contacts. The encoded protein plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. It codistributes with integrins in the cell surface membrane in order to assist in the attachment of adherent cells to extracellular matrices and of lymphocytes to other cells. The N-terminus of this protein contains elements for localization to cell-extracellular matrix junctions. The C-terminus contains binding sites for proteins such as beta-1-integrin, actin, and vinculin. [provided by RefSeq

Sequence: RPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKK

Specifications

• Antigen: TLN1
• Applications: ELISA
• Classification: Monoclonal
• Clone: 2B11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TLN1.
• Formulation: ascites with no preservative
• Gene: TLN1
• Gene Accession No.: BC042923
• Gene Alias: ILWEQ/KIAA1027/TLN
• Gene Symbols: TLN1
• Host Species: Mouse
• Immunogen: TLN1 (AAH42923.1,86 a.a. ∽ 403 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7094
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ