TLR2, Mouse, Clone: 3E3, Abnova™

Catalog No.	Quantity
89-105-623	200 μL

Catalog No. 89-105-623 Supplier Abnova Corporation Supplier No. H00007097M15A

Description

Mouse monoclonal antibody raised against a partial recombinant TLR2.

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is expressed most abundantly in peripheral blood leukocytes, and mediates host response to Gram-positive bacteria and yeast via stimulation of NF-kappaB. [provided by RefSeq

Sequence: KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDV

Specifications

• Antigen: TLR2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3E3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TLR2.
• Formulation: ascites with no preservative
• Gene: TLR2
• Gene Accession No.: BC033756.1
• Gene Alias: CD282/TIL4
• Gene Symbols: TLR2
• Host Species: Mouse
• Immunogen: TLR2 (AAH33756.1,121 a.a. ∽ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7097
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ