Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TLR5, Mouse, Clone: 1E1, Abnova™

Catalog No. 89105628 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-628 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-628 Supplier Abnova Corporation Supplier No. H00007100M07A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant TLR5.

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene product is expressed in myelomonocytic cells, and recognizes bacterial flagellin, a principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB and stimulates tumour necrosis factor-alpha production. [provided by RefSeq

Sequence: LPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCDEEEV

Specifications

Antigen TLR5
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1E1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant TLR5.
Formulation ascites with no preservative
Gene TLR5
Gene Accession No. NM_003268
Gene Alias FLJ10052/MGC126430/MGC126431/SLEB1/TIL3
Gene Symbols TLR5
Host Species Mouse
Immunogen TLR5 (NP_003259,517 a.a. ∽ 634 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7100
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.