Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMPRSS13, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89107425 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-107-425 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-107-425 Supplier Abnova Corporation Supplier No. H00084000A01
Add to Cart
Add to Cart

Mouse polyclonal antibody raised against a partial recombinant TMPRSS13.

Sequence: DGVVDCKLKSDELGCVRFDWDKSLLKIYSGSSHQWLPICSSNWNDSYSEKTCQQLGFESAHRTTEVAHRDFANSFSILRYNSTIQESLHRSECPSQRY

Specifications

Antigen TMPRSS13
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant TMPRSS13.
Formulation 50% glycerol
Gene TMPRSS13
Gene Accession No. NM_032046
Gene Alias MSP/MSPL/MSPS/TMPRSS11
Gene Symbols TMPRSS13
Host Species Mouse
Immunogen TMPRSS13 (NP_114435, 182 a.a. ∽ 279 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 84000
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.