Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89105632

TMSB4X, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89105632 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-632 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-632 Supplier Abnova Corporation Supplier No. H00007114A02
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant TMSB4X.

This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq

Sequence: MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Specifications

Antigen TMSB4X
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant TMSB4X.
Formulation 50% glycerol
Gene TMSB4X
Gene Accession No. NM_021109
Gene Alias FX/PTMB4/TB4X/TMSB4
Gene Symbols TMSB4X
Host Species Mouse
Immunogen TMSB4X (NP_066932, 1 a.a. ∽ 44 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7114
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.