TNFSF9, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-924	50 μL

Catalog No. 89-105-924 Supplier Abnova Corporation Supplier No. H00008744A01

Description

Mouse polyclonal antibody raised against a partial recombinant TNFSF9.

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction

Sequence: FQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Specifications

• Antigen: TNFSF9
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TNFSF9.
• Formulation: 50% glycerol
• Gene: TNFSF9
• Gene Accession No.: NM_003811
• Gene Alias: 4-1BB-L/CD137L
• Gene Symbols: TNFSF9
• Host Species: Mouse
• Immunogen: TNFSF9 (NP_003802, 145 a.a. ∽ 254 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8744
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only