Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89105642

TNP1, Mouse, Clone: 4F12, Abnova™

Catalog No. 89105642 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-642 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-642 Supplier Abnova Corporation Supplier No. H00007141M04A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant TNP1.

Transition protein-1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines (see PRM1, MIM 182880; PRM2, MIM 182890) (Luerssen et al., 1990 [PubMed 2249851]).[supplied by OMIM

Sequence: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL

Specifications

Antigen TNP1
Applications ELISA
Classification Monoclonal
Clone 4F12
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant TNP1.
Formulation ascites with no preservative
Gene TNP1
Gene Accession No. NM_003284
Gene Alias TP1
Gene Symbols TNP1
Host Species Mouse
Immunogen TNP1 (NP_003275.1,1 a.a. ∽ 55 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7141
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.