TRAF6, Mouse, Clone: 1B2, Abnova™

Catalog No.	Quantity
89-105-665	200 μL

Catalog No. 89-105-665 Supplier Abnova Corporation Supplier No. H00007189M02A

Description

Mouse monoclonal antibody raised against a partial recombinant TRAF6.

The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein mediates the signaling not only from the members of the TNF receptor superfamily, but also from the members of the Toll/IL-1 family. Signals from receptors such as CD40, TNFSF11/RANCE and IL-1 have been shown to be mediated by this protein. This protein also interacts with various protein kinases including IRAK1/IRAK, SRC and PKCzeta, which provides a link between distinct signaling pathways. This protein functions as a signal transducer in the NF-kappaB pathway that activates IkappaB kinase (IKK) in response to proinflammatory cytokines. The interaction of this protein with UBE2N/UBC13, and UBE2V1/UEV1A, which are ubiquitin conjugating enzymes catalyzing the formation of polyubiquitin chains, has been found to be required for IKK activation by this protein. Two alternatively spliced transcript variants encoding identical proteins have been reported. [provided by RefSeq

Sequence: TMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV

Specifications

• Antigen: TRAF6
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1B2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TRAF6.
• Formulation: ascites with no preservative
• Gene: TRAF6
• Gene Accession No.: BC031052
• Gene Alias: MGC:3310/RNF85
• Gene Symbols: TRAF6
• Host Species: Mouse
• Immunogen: TRAF6 (AAH31052,413 a.a. ∽ 522 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7189
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2b κ