TRIB2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-776	50 μL

Catalog No. 89-106-776 Supplier Abnova Corporation Supplier No. H00028951A01

Description

Mouse polyclonal antibody raised against a partial recombinant TRIB2.

This gene encodes one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq

Sequence: FHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN

Specifications

• Antigen: TRIB2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TRIB2.
• Formulation: 50% glycerol
• Gene: TRIB2
• Gene Accession No.: NM_021643
• Gene Alias: C5FW/GS3955/TRB2
• Gene Symbols: TRIB2
• Host Species: Mouse
• Immunogen: TRIB2 (NP_067675, 254 a.a. ∽ 343 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 28951
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only