TRIM32 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-542	50 μL

Catalog No. 89-106-542 Supplier Abnova Corporation Supplier No. H00022954A01

Description

Mouse polyclonal antibody raised against a partial recombinant TRIM32.

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes. [provided by RefSeq

Sequence: RRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKEAAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQARYKAVLQEYGHEERRVQDELARSRK

Specifications

• Antigen: TRIM32
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TRIM32.
• Formulation: 50% glycerol
• Gene: TRIM32
• Gene Accession No.: NM_012210
• Gene Alias: BBS11/HT2A/LGMD2H/TATIP
• Gene Symbols: TRIM32
• Host Species: Mouse
• Immunogen: TRIM32 (NP_036342, 105 a.a. ∽ 204 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 22954
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only