TRIM63, Mouse, Clone: 6G6, Abnova™

Catalog No.	Quantity
89-107-459	200 μL

Catalog No. 89-107-459 Supplier Abnova Corporation Supplier No. H00084676M01A

Description

Mouse monoclonal antibody raised against a partial recombinant TRIM63.

This gene encodes a member of the RING zinc finger protein family found in striated muscle and iris. The product of this gene is localized to the Z-line and M-line lattices of myofibrils, where titin's N-terminal and C-terminal regions respectively bind to the sarcomere. In vitro binding studies have shown that this protein also binds directly to titin near the region of titin containing kinase activity. Another member of this protein family binds to microtubules. Since these family members can form heterodimers, this suggests that these proteins may serve as a link between titin kinase and microtubule-dependent signal pathways in muscle. [provided by RefSeq]

Sequence: DKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQGFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEEGH

Specifications

• Antigen: TRIM63
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 6G6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TRIM63.
• Formulation: ascites with no preservative
• Gene: TRIM63
• Gene Accession No.: NM_032588
• Gene Alias: FLJ32380/IRF/MURF1/MURF2/RNF28/SMRZ
• Gene Symbols: TRIM63
• Host Species: Mouse
• Immunogen: TRIM63 (NP_115977,254 a.a. ∽ 352 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 84676
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ