TRPV1, Mouse, Clone: 1F5, Abnova™

Catalog No.	Quantity
89-105-722	200 μL

Catalog No. 89-105-722 Supplier Abnova Corporation Supplier No. H00007442M01A

Description

Mouse monoclonal antibody raised against a partial recombinant TRPV1.

Capsaicin, the main pungent ingredient in hot chili peppers, elicits a sensation of burning pain by selectively activating sensory neurons that convey information about noxious stimuli to the central nervous system. The protein encoded by this gene is a receptor for capsaicin and is a nonselective cation channel that is structurally related to members of the TRP family of ion channels. This receptor is also activated by increases in temperature in the noxious range, suggesting that it functions as a transducer of painful thermal stimuli in vivo. Four transcript variants encoding the same protein, but with different 5' UTR sequence, have been described for this gene. [provided by RefSeq]

Sequence: CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ

Specifications

• Antigen: TRPV1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1F5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TRPV1.
• Formulation: ascites with no preservative
• Gene: TRPV1
• Gene Accession No.: NM_080706
• Gene Alias: DKFZp434K0220/VR1
• Gene Symbols: TRPV1
• Host Species: Mouse
• Immunogen: TRPV1 (NP_542437,21 a.a. ∽ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7442
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ