Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TSNAX, Mouse, Clone: 4D5, Abnova™

Catalog No. 89105672 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-672 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-672 Supplier Abnova Corporation Supplier No. H00007257M02A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant TSNAX.

This gene encodes a protein which specifically interacts with translin, a DNA-binding protein that binds consensus sequences at breakpoint junctions of chromosomal translocations. The encoded protein contains bipartite nuclear targeting sequences that may provide nuclear transport for translin, which lacks any nuclear targeting motifs. [provided by RefSeq

Sequence: VADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKTEMIDQEEGIS

Specifications

Antigen TSNAX
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4D5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant TSNAX.
Formulation ascites with no preservative
Gene TSNAX
Gene Accession No. NM_005999
Gene Alias TRAX
Gene Symbols TSNAX
Host Species Mouse
Immunogen TSNAX (NP_005990.1,191 a.a. ∽ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7257
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.