TSPAN7, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-630	50 μL

Catalog No. 89-105-630 Supplier Abnova Corporation Supplier No. H00007102A01

Description

Mouse polyclonal antibody raised against a partial recombinant TSPAN7.

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and may have a role in the control of neurite outgrowth. It is known to complex with integrins. This gene is associated with X-linked mental retardation and neuropsychiatric diseases such as Huntington's chorea, fragile X syndrome and myotonic dystrophy. [provided by RefSeq]

Sequence: RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETN

Specifications

• Antigen: TSPAN7
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TSPAN7.
• Formulation: 50% glycerol
• Gene: TSPAN7
• Gene Accession No.: NM_004615
• Gene Alias: A15/CCG-B7/CD231/DXS1692E/MRX58/MXS1/TALLA-1/TM4SF2/TM4SF2b
• Gene Symbols: TSPAN7
• Host Species: Mouse
• Immunogen: TSPAN7 (NP_004606, 113 a.a. ∽ 212 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7102
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only