UBE2E3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-328	50 μL

Catalog No. 89-106-328 Supplier Abnova Corporation Supplier No. H00010477A01

Description

Mouse polyclonal antibody raised against a partial recombinant UBE2E3.

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse and rat counterparts, which indicates that this enzyme is highly conserved in eukaryotes. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: RIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDN

Specifications

• Antigen: UBE2E3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant UBE2E3.
• Formulation: 50% glycerol
• Gene: UBE2E3
• Gene Accession No.: NM_006357
• Gene Alias: UBCH9/UbcM2
• Gene Symbols: UBE2E3
• Host Species: Mouse
• Immunogen: UBE2E3 (NP_006348, 65 a.a. ∽ 152 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10477
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only