UBE2L6, Mouse, Clone: S1, Abnova™

Catalog No.	Quantity
89-106-038	200 μL

Catalog No. 89-106-038 Supplier Abnova Corporation Supplier No. H00009246M01A

Description

Mouse monoclonal antibody raised against a full-length recombinant UBE2L6.

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by UBE2L3 gene. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq

Sequence: MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS

Specifications

• Antigen: UBE2L6
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: S1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant UBE2L6.
• Formulation: ascites with no preservative
• Gene: UBE2L6
• Gene Accession No.: BC032491
• Gene Alias: MGC40331/RIG-B/UBCH8
• Gene Symbols: UBE2L6
• Host Species: Mouse
• Immunogen: UBE2L6 (AAH32491,1 a.a. ∽ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9246
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ