UBE4B, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-274	50 μL

Catalog No. 89-106-274 Supplier Abnova Corporation Supplier No. H00010277A01

Description

Mouse polyclonal antibody raised against a partial recombinant UBE4B.

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. This gene is also the strongest candidate in the neuroblastoma tumor suppressor genes. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq

Sequence: FKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH

Specifications

• Antigen: UBE4B
• Applications: ELISA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant UBE4B.
• Formulation: 50% glycerol
• Gene: UBE4B
• Gene Accession No.: NM_006048
• Gene Alias: E4/HDNB1/KIAA0684/UBOX3/UFD2
• Gene Symbols: UBE4B
• Host Species: Mouse
• Immunogen: UBE4B (NP_006039, 1075 a.a. ∽ 1173 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10277
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only