UCP1, Mouse, Clone: 4B7, Abnova™

Catalog No.	Quantity
89-105-701	200 μL

Catalog No. 89-105-701 Supplier Abnova Corporation Supplier No. H00007350M03A

Description

Mouse monoclonal antibody raised against a partial recombinant UCP1.

Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed only in brown adipose tissue, a specialized tissue which functions to produce heat. [provided by RefSeq]

Sequence: PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF

Specifications

• Antigen: UCP1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4B7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant UCP1.
• Formulation: ascites with no preservative
• Gene: UCP1
• Gene Accession No.: NM_021833
• Gene Alias: SLC25A7/UCP
• Gene Symbols: UCP1
• Host Species: Mouse
• Immunogen: UCP1 (NP_068605,232 a.a. ∽ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7350
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ