UGT1A9, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-982	50 μL

Catalog No. 89-106-982 Supplier Abnova Corporation Supplier No. H00054600A01

Description

Mouse polyclonal antibody raised against a partial recombinant UGT1A9.

This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenols. [provided by RefSeq]

Sequence: KLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLGRSLNCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLFFSNCRSLFKDKKLVEY

Specifications

• Antigen: UGT1A9
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant UGT1A9.
• Formulation: 50% glycerol
• Gene: UGT1A9
• Gene Accession No.: NM_021027
• Gene Alias: HLUGP4/LUGP4/UDPGT/UGT1AI
• Gene Symbols: UGT1A9
• Host Species: Mouse
• Immunogen: UGT1A9 (NP_066307, 27 a.a. ∽ 136 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 54600
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only