UNC13B, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-334	50 μL

Catalog No. 89-106-334 Supplier Abnova Corporation Supplier No. H00010497A01

Description

Mouse polyclonal antibody raised against a partial recombinant UNC13B.

This gene is expressed in the kidney cortical epithelial cells and is upregulated by hyperglycemia. The encoded protein shares a high level of similarity to the rat homolog, and contains 3 C2 domains and a diacylglycerol-binding C1 domain. Hyperglycemia increases the levels of diacylglycerol, which has been shown to induce apoptosis in cells transfected with this gene and thus contribute to the renal cell complications of hyperglycemia. Studies in other species also indicate a role for this protein in the priming step of synaptic vesicle exocytosis. [provided by RefSeq

Sequence: SKSNNWAPKYNETFHLLLGNEEGPESYELQICVKDYCFAREDRVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGLTILRILSQRSNDEVAREFVKLKSESRSTEEGS

Specifications

• Antigen: UNC13B
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant UNC13B.
• Formulation: 50% glycerol
• Gene: UNC13B
• Gene Accession No.: NM_006377
• Gene Alias: MGC133279/MGC133280/MUNC13/UNC13/Unc13h2/hmunc13
• Gene Symbols: UNC13B
• Host Species: Mouse
• Immunogen: UNC13B (NP_006368, 1482 a.a. ∽ 1591 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10497
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only