Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

USP9X, Mouse, Clone: 2A9, Abnova™

Catalog No. 89105824 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-824 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-824 Supplier Abnova Corporation Supplier No. H00008239M08A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant USP9X.

This gene is a member of the peptidase C19 family and encodes a protein that is similar to ubiquitin-specific proteases. Though this gene is located on the X chromosome, it escapes X-inactivation. Mutations in this gene have been associated with Turner syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLP

Specifications

Antigen USP9X
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2A9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant USP9X.
Formulation ascites with no preservative
Gene USP9X
Gene Accession No. NM_021906
Gene Alias DFFRX/FAF/FAM
Gene Symbols USP9X
Host Species Mouse
Immunogen USP9X (NP_068706,1 a.a. ∽ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8239
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.