VIL1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant VIL1.

Supplier:  Abnova Corporation H00007429A01

Catalog No. 89-105-720

Description

This gene encodes a member of a family of calcium-regulated actin-binding proteins. This protein represents a dominant part of the brush border cytoskeleton which functions in the capping, severing, and bundling of actin filaments. Two mRNAs of 2.7kb and 3.5kb have been observed; they result from utilization of alternate poly-adenylation signals present in the terminal exon. [provided by RefSeq

Sequence: MTKLSAQVKGSLNITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDSSLDEQGA

Specifications

• Antigen: VIL1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant VIL1.
• Gene: VIL1
• Gene Alias: D2S1471/VIL
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_007127
• Gene Symbols: VIL1
• Immunogen: VIL1 (NP_009058, 1 a.a. ∽ 77 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 7429
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only