VRK1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-723	50 μL

Catalog No. 89-105-723 Supplier Abnova Corporation Supplier No. H00007443A01

Description

Mouse polyclonal antibody raised against a partial recombinant VRK1.

This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. This gene is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN. [provided by RefSeq

Sequence: DKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK

Specifications

• Antigen: VRK1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant VRK1.
• Formulation: 50% glycerol
• Gene: VRK1
• Gene Accession No.: NM_003384
• Gene Alias: MGC117401/MGC138280/MGC142070
• Gene Symbols: VRK1
• Host Species: Mouse
• Immunogen: VRK1 (NP_003375, 287 a.a. ∽ 396 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7443
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only