WASF2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-232	50 μL

Catalog No. 89-106-232 Supplier Abnova Corporation Supplier No. H00010163A01

Description

Mouse polyclonal antibody raised against a partial recombinant WASF2.

This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. The published map location (PMID:10381382) has been changed based on recent genomic sequence comparisons, which indicate that the expressed gene is located on chromosome 1, and a pseudogene may be located on chromosome X. [provided by RefSeq

Sequence: DRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIM

Specifications

• Antigen: WASF2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant WASF2.
• Formulation: 50% glycerol
• Gene: WASF2
• Gene Accession No.: NM_006990
• Gene Alias: SCAR2/WAVE2/dJ393P12.2
• Gene Symbols: WASF2
• Host Species: Mouse
• Immunogen: WASF2 (NP_008921, 73 a.a. ∽ 172 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10163
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only