WDR19, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-107-216	50 μL

Catalog No. 89-107-216 Supplier Abnova Corporation Supplier No. H00057728A01

Description

Mouse polyclonal antibody raised against a partial recombinant WDR19.

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains six WD repeats, a clathrin heavy-chain repeat, and three transmembrane domains. This gene is conserved from C. elegans to human. It may participate in androgen-regulated signaling mechanisms or in the vesicular trafficking of androgen-regulated secretory processes. Alternatively spliced transcript variants encoding distinct isoforms have been reported but the full-length nature of one of these variants has not been defined. [provided by RefSeq

Sequence: MKRIFSLLEKTWLGAPIQFAWQKTSGNYLAVTGADYIVKIFDRHGQKRSEINLPGNCVAMDWDKDGDVLAVIAEKSSCIYLWDANTNKTSQLDNGMRDQ

Specifications

• Antigen: WDR19
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant WDR19.
• Formulation: 50% glycerol
• Gene: WDR19
• Gene Accession No.: NM_025132
• Gene Alias: FLJ23127/KIAA1638/ORF26/PWDMP
• Gene Symbols: WDR19
• Host Species: Mouse
• Immunogen: WDR19 (NP_079408, 1 a.a. ∽ 99 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 57728
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only