Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WDR5, Mouse, Clone: 2C2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant WDR5.

Manufacturer:  Abnova Corporation H00011091M01A

Catalog No. 89-106-459


Add to cart

Description

Description

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq

Sequence: QPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGK
Specifications

Specifications

WDR5
Monoclonal
Unconjugated
ascites with no preservative
NM_017588
BIG-3/SWD3
Mouse
IgG2b Kappa
RUO
Antibody
Monoclonal
Human
ELISA, Western Blot
2C2
Mouse monoclonal antibody raised against a partial recombinant WDR5.
WDR5
Ascites
WDR5
WDR5 (NP_060058,16 a.a. ∽ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
200 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
11091
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit