WHSC2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-729	50 μL

Catalog No. 89-105-729 Supplier Abnova Corporation Supplier No. H00007469A01

Description

Mouse polyclonal antibody raised against a partial recombinant WHSC2.

This gene is expressed ubiquitously with higher levels in fetal than in adult tissues. It encodes a protein sharing 93% sequence identity with the mouse protein. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. This gene is mapped to the 165kb WHS critical region, and may play a role in the phenotype of the WHS or Pitt-Rogers-Danks syndrome. The encoded protein is found to be capable of reacting with HLA-A2-restricted and tumor-specific cytotoxic T lymphocytes, suggesting a target for use in specific immunotherapy for a large number of cancer patients. This protein has also been shown to be a member of the NELF (negative elongation factor) protein complex that participates in the regulation of RNA polymerase II transcription elongation. [provided by RefSeq

Sequence: KNLSLTREQMFAAQEMFKTANKVTRPEKALILGFMAGSRENPCQEQGDVIQIKLSEHTEDLPKADGQGSTTMLVDTVFEMNYATGQWTRFKKYKPMTNV

Specifications

• Antigen: WHSC2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant WHSC2.
• Formulation: 50% glycerol
• Gene: WHSC2
• Gene Accession No.: NM_005663
• Gene Alias: FLJ10442/FLJ25112/NELF-A/NELFA/P/OKcl.15
• Gene Symbols: WHSC2
• Host Species: Mouse
• Immunogen: WHSC2 (NP_005654, 429 a.a. ∽ 527 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7469
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only