WWP1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-448	50 μL

Catalog No. 89-106-448 Supplier Abnova Corporation Supplier No. H00011059A01

Description

Mouse polyclonal antibody raised against a partial recombinant WWP1.

WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. The encoded protein belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. Alternative splicing of this gene generates at least 6 transcript variants; however, the full length nature of these transcripts has not been defined. [provided by RefSeq

Sequence: CSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGT

Specifications

• Antigen: WWP1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant WWP1.
• Formulation: 50% glycerol
• Gene: WWP1
• Gene Accession No.: NM_007013
• Gene Alias: AIP5/DKFZp434D2111/Tiul1/hSDRP1
• Gene Symbols: WWP1
• Host Species: Mouse
• Immunogen: WWP1 (NP_008944, 152 a.a. ∽ 260 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 11059
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only