Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89106192

ZBTB33, Mouse, Clone: 2B2, Abnova™

Catalog No. 89106192 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-192 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-192 Supplier Abnova Corporation Supplier No. H00010009M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant ZBTB33.

KAISO is a transcriptional regulator that binds, via its zinc fingers, to DNA sequences containing methylated CGCG or to the consensus KAISO-binding site (KBS) TCCTGCNA (Filion et al., 2006 [PubMed 16354688]).[supplied by OMIM

Sequence: QFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY

Specifications

Antigen ZBTB33
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2B2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ZBTB33.
Formulation ascites with no preservative
Gene ZBTB33
Gene Accession No. BC042753
Gene Alias ZNF-kaiso/ZNF348
Gene Symbols ZBTB33
Host Species Mouse
Immunogen ZBTB33 (AAH42753,564 a.a. ∽ 673 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10009
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.