ZBTB33, Mouse, Clone: 2B2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ZBTB33.

Supplier:  Abnova Corporation H00010009M01A

Catalog No. 89-106-192

Description

KAISO is a transcriptional regulator that binds, via its zinc fingers, to DNA sequences containing methylated CGCG or to the consensus KAISO-binding site (KBS) TCCTGCNA (Filion et al., 2006 [PubMed 16354688]).[supplied by OMIM

Sequence: QFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY

Specifications

• Antigen: ZBTB33
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC042753
• Gene Symbols: ZBTB33
• Immunogen: ZBTB33 (AAH42753,564 a.a. ∽ 673 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 10009
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 2B2
• Description: Mouse monoclonal antibody raised against a partial recombinant ZBTB33.
• Gene: ZBTB33
• Gene Alias: ZNF-kaiso/ZNF348
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ