ZFHX3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-118	50 μL

Catalog No. 89-104-118 Supplier Abnova Corporation Supplier No. H00000463A01

Description

Mouse polyclonal antibody raised against a partial recombinant ZFHX3.

This gene encodes a transcription factor with multiple homeodomains and zinc finger motifs, and regulates myogenic and neuronal differentiation. The encoded protein suppresses expression of the alpha-fetoprotein gene by binding to an AT-rich enhancer motif. The protein has also been shown to negatively regulate c-Myb, and transactivate the cell cycle inhibitor cyclin-dependent kinase inhibitor 1A (also known as p21CIP1). This gene is reported to function as a tumor suppressor in several cancers, and sequence variants of this gene are also associated with atrial fibrillation. Multiple transcript variants expressed from alternate promoters and encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: EDFESPSMSSVNLNFDQTKLDNDDCSSVNTAITDTTTGDEGNADNDSATGIATETKSSSAPNEGLTKAAMMAMSEYEDRLSSGLVSPAPSFYSKEYDNEG

Specifications

• Antigen: ZFHX3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ZFHX3.
• Formulation: 50% glycerol
• Gene: ZFHX3
• Gene Accession No.: NM_006885
• Gene Alias: ATBF1/ATBT
• Gene Symbols: ZFHX3
• Host Species: Mouse
• Immunogen: ZFHX3 (NP_008816, 2811 a.a. ∽ 2910 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 463
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only