ZFP36L1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-168	50 μL

Catalog No. 89-104-168 Supplier Abnova Corporation Supplier No. H00000677A01

Description

Mouse polyclonal antibody raised against a partial recombinant ZFP36L1.

This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors. [provided by RefSeq

Sequence: MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGG

Specifications

• Antigen: ZFP36L1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ZFP36L1.
• Formulation: 50% glycerol
• Gene: ZFP36L1
• Gene Accession No.: NM_004926
• Gene Alias: BRF1/Berg36/ERF-1/ERF1/RNF162B/TIS11B/cMG1
• Gene Symbols: ZFP36L1
• Host Species: Mouse
• Immunogen: ZFP36L1 (NP_004917, 1 a.a. ∽ 108 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 677
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only