Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZIC1, Mouse, Clone: 1D12, Abnova™

Catalog No. 89105747 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-747 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-747 Supplier Abnova Corporation Supplier No. H00007545M04A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant ZIC1.

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development. Aberrant expression of this gene is seen in medulloblastoma, a childhood brain tumor. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 4, a related family member on chromosome 3. This gene encodes a transcription factor that can bind and transactivate the apolipoprotein E gene. [provided by RefSeq

Sequence: LLDAGPQYPAIGVTTFGASRHHSAGDVAERDVGLGINPFADGMGAFKLNPSSHELASAGQTAFTSQAPGYAAAAALGHHHHPGHVGSYSSAAFN

Specifications

Antigen ZIC1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1D12
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ZIC1.
Formulation ascites with no preservative
Gene ZIC1
Gene Accession No. NM_003412
Gene Alias ZIC/ZNF201
Gene Symbols ZIC1
Host Species Mouse
Immunogen ZIC1 (NP_003403,2 a.a. ∽ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7545
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.