Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Mouse Csf1 (P07141) Recombinant Protein

Catalog No. 89940688
Click to view available options
Quantity:
10 μg

Used for Func, SDS-PAGE

Sequence: MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP

Specifications

Accession Number P07141
For Use With (Application) Functional Study, SDS-PAGE
Formulation Lyophilized
Gene ID (Entrez) 12977
Molecular Weight (g/mol) 36.8kDa
Name Csf1 (Mouse) Recombinant Protein
Preparation Method Escherichia coli expression system
Quality Control Testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Quantity 10 μg
Immunogen MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP
Storage Requirements Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Endotoxin Concentration <0.1 EU/μg
Gene Alias C87615/CSF-1/Csfm/M-CSF/op
Common Name Csf1
Gene Symbol Csf1
Biological Activity The activity is determined by the dose-dependent induction of M-NFS-60 cell proliferation. The expected ED50 for this effect is 1.1-1.6ng/mL.
Species E. coli
Recombinant Recombinant
Protein Tag None
Expression System Escherichia coli expression system
Form Lyophilized
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.