Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89944921

Abnova™ Mouse Flt3l (P49772, 27 a.a. - 189 a.a.) Partial Recombinant Protein

Catalog No. 89944921 Shop All Abnova Corporation Products
Click to view available options
Quantity:
10 μg

Description

Used for Func, SDS-PAGE

Sequence: GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQ

Specifications

Accession Number P49772
For Use With (Application) Functional Study, SDS-PAGE
Formulation Lyophilized
Gene ID (Entrez) 14256
Molecular Weight (g/mol) 32kDa
Name Flt3l (Mouse) Recombinant Protein
Preparation Method Escherichia coli expression system
Purification Method Ion exchange column and HPLC reverse phase column
Quantity 10 μg
Immunogen GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQ
Storage Requirements Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Endotoxin Concentration <0.1ng/μg (1EU/μg) (determined by LAL gel clot method)
Gene Alias Flt3lg/Ly72L
Common Name Flt3l
Gene Symbol Flt3l
Biological Activity The ED50 was determined by the dose-dependent proliferation of human AML5 cells was found to be in the range of 10.0ng/mL.
Species E. coli
Recombinant Recombinant
Protein Tag None
Expression System Escherichia coli expression system
Form Lyophilized
Purity or Quality Grade >90% by SDS-PAGE and HPLC
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.