Abnova™ Mouse Kitl (P20826, 36 a.a. - 189 a.a.) Partial Recombinant Protein expressed in Insect cells

Description

Used for Func, SDS-PAGE

Sequence: KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Specifications

• Accession Number: P20826
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 17311
• Molecular Weight (g/mol): 18kDa
• Name: Kitl (Mouse) Recombinant Protein
• Preparation Method: Insect cell expression system
• Purification Method: Ion exchange column and HPLC reverse phase column
• Quantity: 10 μg
• Immunogen: KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
• Storage Requirements: Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1ng/μg (1EU/μg) (determined by LAL gel clot method)
• Gene Alias: Clo/Con/Gb/Kitlg/Mgf/SCF/SF/SLF/Sl/Steel/contrasted
• Common Name: Kitl
• Gene Symbol: Kitl
• Biological Activity: The ED50 was determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is < 2.0ng/mL, corresponding to a specific activity of ≥ 5 x 10⁵ units/mg.
• Species: Baculovirus
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Insect cell expression system
• Form: Lyophilized
• Purity or Quality Grade: >90% by SDS-PAGE and HPLC