Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MOV10L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MOV10L1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MOV10L1 Polyclonal specifically detects MOV10L1 in Human samples. It is validated for Western Blot.Specifications
MOV10L1 | |
Polyclonal | |
Rabbit | |
Q9BXT6 | |
54456 | |
Synthetic peptides corresponding to MOV10L1(Mov10l1, Moloney leukemia virus 10-like 1, homolog (mouse)) The peptide sequence was selected from the N terminal of MOV10L1. Peptide sequence LNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DJ402G11.8, DKFZp434B0717, EC 3.6.1, EC 3.6.4.13, FLJ33421, Moloney leukemia virus 10-like protein 1, Mov10 (mouse)-like 1, Mov10l1, Moloney leukemia virus 10-like 1, homolog (mouse), Mov10-like 1, MOV10-like protein 1, putative helicase Mov10l1 | |
MOV10L1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title