Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579692

Invitrogen™ MPP1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579692
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579692 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579692 Supplier Invitrogen™ Supplier No. PA579692
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat lung tissue, mouse spleen tissue, MCF-7 whole cell. ICC/IF: MCF7 cell. Flow: U87 cell.

This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MPP1
Applications Western Blot, Immunocytochemistry, Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.01mg sodium azide
Gene MPP1
Gene Accession No. P70290, Q00013
Gene Alias 55 kDa erythrocyte membrane protein; 55kDa; AAG12; aging-associated gene 12; C130070C03Rik; DXS552E; EMP55; erythrocyte membrane protein p55; LOC652956; membrane palmitoylated protein 1; membrane protein, palmitoylated; membrane protein, palmitoylated 1; membrane protein, palmitoylated 1, 55kDa; migration-related gene 1; MPP1; MRG1; p55; p55 protein; palmitoylated erythrocyte membrane protein; PEMP
Gene Symbols MPP1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human MPP1 (409-450aa TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 17524, 4354, 652956
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.