Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MPP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP317060100UL

 View more versions of this product

Catalog No. NB169196


Only null left
Add to Cart
This item is not returnable. View return policy

Description

Description

MPP2 Polyclonal antibody specifically detects MPP2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications

Specifications

MPP2
Polyclonal
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Discs large homolog 2, DKFZp686A06252, DKFZp686J2189, DKFZp761D0712, DLG2discs large, homolog 2, MAGUK p55 subfamily member 2, membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2), Protein MPP2
This antibody was developed against Recombinant Protein corresponding to amino acids: GLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVT
100 μg
Primary
Human
Purified
Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS, pH 7.2, 40% glycerol
Rabbit
Affinity purified
RUO
4355
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.