Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MPP7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | MPP7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1530820
|
Novus Biologicals
NBP15308120UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP153081
|
Novus Biologicals
NBP153081 |
100 μL |
Each for $487.50
|
|
|||||
Description
MPP7 Polyclonal specifically detects MPP7 in Human samples. It is validated for Western Blot.Specifications
| MPP7 | |
| Polyclonal | |
| Rabbit | |
| Q5T2T1 | |
| 143098 | |
| Synthetic peptides corresponding to MPP7(membrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7)) The peptide sequence was selected from the N terminal of MPP7. Peptide sequence MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ32798, MAGUK p55 subfamily member 7, membrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7) | |
| MPP7 | |
| IgG | |
| 65 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title