Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MPP7 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen MPP7
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1530820
View Documents
Novus Biologicals
NBP15308120UL
20 μL
Each for $152.22
Add to cart
 
NBP153081
View Documents
Novus Biologicals
NBP153081
100 μL
Each for $436.00
Add to cart
 
Description

Description

MPP7 Polyclonal specifically detects MPP7 in Human samples. It is validated for Western Blot.
Specifications

Specifications

MPP7
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
FLJ32798, MAGUK p55 subfamily member 7, membrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7)
MPP7
IgG
Affinity Purified
65 kDa
Western Blot
Unconjugated
RUO
Q5T2T1
143098
Synthetic peptides corresponding to MPP7(membrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7)) The peptide sequence was selected from the N terminal of MPP7. Peptide sequence MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSL.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit