Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MPST Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$208.00 - $532.07
Specifications
| Antigen | MPST |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15473420
|
Novus Biologicals
NBP15473420UL |
20 μL |
Each for $208.00
|
|
|||||
|
NBP154734
|
Novus Biologicals
NBP154734 |
100 μL |
Each for $532.07
|
|
|||||
Description
MPST Polyclonal specifically detects MPST in Human samples. It is validated for Western Blot.Specifications
| MPST | |
| Polyclonal | |
| Rabbit | |
| P25325 | |
| 4357 | |
| Synthetic peptides corresponding to MPST(mercaptopyruvate sulfurtransferase) The peptide sequence was selected from the middle region of MPST. Peptide sequence DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| mercaptopyruvate sulfurtransferase, MGC24539, MSThuman liver rhodanese, TST2EC 2.8.1.2,3-mercaptopyruvate sulfurtransferase | |
| MPST | |
| IgG | |
| 33 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title