Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MRO Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MRO |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MRO Polyclonal specifically detects MRO in Human samples. It is validated for Western Blot.Specifications
MRO | |
Polyclonal | |
Rabbit | |
NP_001120648 | |
83876 | |
Synthetic peptide directed towards the C terminal of human MROThe immunogen for this antibody is MRO. Peptide sequence VAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFF. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
B29FLJ30140, beside the Ma29 deletion, C18orf3, chromosome 18 open reading frame 3, maestro, Male-specific transcription in the developing reproductive organs, Protein B29, protein maestro | |
MRO | |
IgG | |
30 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title