Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MRO Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179844
Description
MRO Polyclonal specifically detects MRO in Human samples. It is validated for Western Blot.Specifications
MRO | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
B29FLJ30140, beside the Ma29 deletion, C18orf3, chromosome 18 open reading frame 3, maestro, Male-specific transcription in the developing reproductive organs, Protein B29, protein maestro | |
Rabbit | |
30 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Dog: 85%; Horse: 85%; Bovine: 85%; Rabbit: 85%; Rat: 77%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_001120648 | |
MRO | |
Synthetic peptide directed towards the C terminal of human MROThe immunogen for this antibody is MRO. Peptide sequence VAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFF. | |
Affinity purified | |
RUO | |
83876 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction