Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MRP1 Antibody (IU5C1), mFluor Violet 450 SE, Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NB11057131MFV450
Description
MRP1 Monoclonal antibody specifically detects MRP1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
MRP1 | |
Monoclonal | |
mFluor Violet 450 SE | |
50mM Sodium Borate | |
Mouse | |
Protein G purified | |
RUO | |
Primary | |
Human, Mouse | |
Purified |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
IU5C1 | |
Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin | |
ABC29, ABCC, ATP-binding cassette sub-family C member 1, ATP-binding cassette, sub-family C (CFTR/MRP), member 1, EC 3.6.3, EC 3.6.3.44, GS-X, Leukotriene C(4) transporter, LTC4 transporter, MRP1DKFZp781G125, MRPDKFZp686N04233, multidrug resistance associated protein 1, multidrug resistance protein, multidrug resistance-associated protein 1, multiple drug resistance protein 1, multiple drug resistance-associated protein | |
A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527] | |
0.1 mL | |
ABC Transporters, Amino Acids Drugs and other small molecules, Cancer, Lipid and Metabolism, Plasma Membrane Markers, Signal Transduction | |
4363 | |
Store at 4C in the dark. | |
IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction