Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MRPL10 Antibody, Novus Biologicals™

MRPL10 Antibody, Novus Biologicals™
SDP

Catalog No. p-200058065 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396092 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB396092 Supplier Novus Biologicals Supplier No. NBP24859025UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

MRPL10 Polyclonal antibody specifically detects MRPL10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen MRPL10
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias L10mt, MGC17973, mitochondrial ribosomal protein L10, MRP-L10L8mt, MRP-L839S ribosomal protein L10, mitochondrial, MRPL839S ribosomal protein L8, mitochondrial, RPML8L10MT
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: RLPTLQTVRYGSKAVTRHRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRREIAAVFQDNRMIAVCQ
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 124995
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.