Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MRPL15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MRPL15 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MRPL15 Polyclonal specifically detects MRPL15 in Human samples. It is validated for Western Blot.Specifications
MRPL15 | |
Polyclonal | |
Rabbit | |
Core ESC Like Genes, Stem Cell Markers | |
L15mtHSPC145, mitochondrial ribosomal protein L15, MRP-L1539S ribosomal protein L15, mitochondrial, MRP-L7, RPML7 | |
MRPL15 | |
IgG | |
33 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q9P015 | |
29088 | |
Synthetic peptides corresponding to MRPL15(mitochondrial ribosomal protein L15) The peptide sequence was selected from the N terminal of MRPL15. Peptide sequence KPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKYGFN. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title