Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MRPL15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | MRPL15 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MRPL15 Polyclonal specifically detects MRPL15 in Human samples. It is validated for Western Blot.Specifications
| MRPL15 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| L15mtHSPC145, mitochondrial ribosomal protein L15, MRP-L1539S ribosomal protein L15, mitochondrial, MRP-L7, RPML7 | |
| MRPL15 | |
| IgG | |
| 33 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9P015 | |
| 29088 | |
| Synthetic peptides corresponding to MRPL15(mitochondrial ribosomal protein L15) The peptide sequence was selected from the N terminal of MRPL15. Peptide sequence KPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKYGFN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title